Synthesis and expression in Escherichia coli of the gene encoding monocyte-derived neutrophil-activating factor: biological equivalence between natural and recombinant neutrophil-activating factor.
- 1 December 1988
- journal article
- research article
- Published by Proceedings of the National Academy of Sciences in Proceedings of the National Academy of Sciences of the United States of America
- Vol. 85 (23), 9199-9203
- https://doi.org/10.1073/pnas.85.23.9199
Abstract
The neutrophil-activating factor (NAF) purified from the conditioned medium of lipopolysaccharide-stimulated human monocytes was sequenced and found to consist of 72 amino acids: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRA ENS. Purified preparations of natural NAF contained, in addition to this main form, minor amounts of three amino-terminal variants with 77 (+AVLPR), 70, and 69 residues. A gene coding for the 72-amino acid NAF was synthesized, cloned, and expressed in Escherichia coli. Western (immunologic) blot analysis of crude bacterial extracts, with an antiserum raised against natural NAF, revealed a single band that comigrated with natural NAF. Recombinant NAF purified to homogeneity had identical amino- and carboxyl-terminal sequences to the 72-amino acid natural NAF. Recombinant NAF was tested on human neutrophils and had the same activity and potency as natural NAF in inducing chemotaxis, rapidly increasing cytosolic free Ca2+, activating the respiratory burst, and releasing specific and azurophilic granular contents.Keywords
This publication has 29 references indexed in Scilit:
- Cloning and characterization of a cDNA for murine macrophage inflammatory protein (MIP), a novel monokine with inflammatory and chemokinetic properties.The Journal of Experimental Medicine, 1988
- Molecular cloning of a human monocyte-derived neutrophil chemotactic factor (MDNCF) and the induction of MDNCF mRNA by interleukin 1 and tumor necrosis factor.The Journal of Experimental Medicine, 1988
- A novel neutrophil-activating factor produced by human mononuclear phagocytes.The Journal of Experimental Medicine, 1988
- A novel, NH2-terminal sequence-characterized human monokine possessing neutrophil chemotactic, skin-reactive, and granulocytosis-promoting activity.The Journal of Experimental Medicine, 1988
- Structure determination of a human lymphocyte derived neutrophil activating peptide (LYNAP)Biochemical and Biophysical Research Communications, 1988
- Purification and amino acid sequencing of NAF, a novel neutrophil-activating factor produced by monocytesBiochemical and Biophysical Research Communications, 1987
- Studies on transformation of Escherichia coli with plasmidsJournal of Molecular Biology, 1983
- Trans-complementable copy-number mutants of plasmid ColE1Nature, 1980
- Complete covalent structure of human .beta.-thromboglobulinBiochemistry, 1978
- Selective S-methylation of cysteine in proteins and peptidesBiochemical and Biophysical Research Communications, 1970