Science Evolution

Journal Information
ISSN / EISSN : 2500-4239 / 2500-1418
Published by: Kemerovo State University (10.21603)
Total articles ≅ 55
Filter:

Latest articles in this journal

Valery Pavsky, Kirill Pavsky,
Published: 30 December 2017
Science Evolution, Volume 2, pp 79-87; https://doi.org/10.21603/2500-1418-2017-2-2-79-87

Abstract:
A random Bernoulli process with continuous time and a finite number of states (random events) is proposed. The process is obtained by two mutually complementary methods - directly from the Poisson process with an intensity parameter that depends on time and methods of queuing theory, from a queuing system with two parameters. In the first case, the process was formalized on a probability space with measure, as a measurable function of time. The intensity of the Poisson process was considered as a measure. The Bernoulli process for each fixed time was obtained as a conditional distribution from a suitable Poisson distribution. The parameter of the Poisson distribution was determined from the differential equation, in the formulation of which the approximation of the Bernoulli formula by the Poisson formula was essentially used. In the second method, standard methods of queuing theory were used. A two- parameter queuing model was formulated in which for all customer flows the time between occurrence of neighboring customers was a random value satisfying the exponential law. The model was formalized by a system of differential equations, whose analytical solution represented the continuous-time Bernoulli process. In finding solutions, the method of generating functions was used. It is of interest to derive the Bernoulli process both from the probability space constructed for the Poisson process and from the queuing theory model. The authors believe that the proposed process can be generalized to a wider class of functions than that used in the work, down to measurable ones. The possibilities for the practical application of the continuous-time Bernoulli process will undoubtedly be expanded, since its discrete analog is well known in many fields of science and technology.
Ilya Vasilchenko, Alexey Osintsev, Paul Stauffer, Ilya Loyko, Dmitriy Pastushenko, Olga Zharkova, Vladimir Braginsky, Vitaliy Rynk, Natalia Vasilchenko
Published: 30 December 2017
Science Evolution, Volume 2, pp 15-21; https://doi.org/10.21603/2500-1418-2017-2-2-15-21

Abstract:
Hyperthermia, i.e. tissue heating to a temperature of 39-45°C, is considered to be a very promising technique to increase the sensitivity of tumor cells to ionizing radiation and chemical preparations. At the present time, there are numerous methods for producing hyperthermia with the optimum method dependent on the required volume, depth, and site of heating. This paper presents the results of preliminary theoretical and in vivo confirmation studies of the feasibility of intraoperative local hyperthermia via induction heating of ferromagnetic material within a tumor bed implant that fills a resected tumor cavity. The implant is made during the surgical removal of tumor by mechanically filling the tumor bed with a self-polymerizing silicone paste in which very fine electroconductive ferromagnetic particles are uniformly distributed. Therefore, the implant can accommodate unique characteristics of each patient’s tumor bed. For the laboratory experiments, a prototype induction heating system was used to produce an alternating magnetic field with a frequency of about 100 kHz and a maximum intensity up to 3 kA/m inside an induction coil of inner diameter 35 cm. Experiments were conducted to heat a 2.5 cm diameter spherical implant both in open air and inside the thigh of a living rabbit. The results in both cases are in good agreement with our theoretical estimations. It was established that the temperature gradient near the implant surface decreases with increasing implant size, and for typical size tumor bed implants produces effective hyperthermia to a distance of more than 5 mm from the implant surface. This result provides hope for a decrease in relapse after treatment of malignant tumors using our combination heat plus intraoperative high dose rate local radiotherapy approach. Moreover, the externally coupled implant heating can be combined with local chemotherapy by applying a self-resorbable polymer film containing antineoplastic agents to the surface of the implant.
Larisa Sotnikova, Polina Goryunova, Sergey Sozinov, Natal’Ya Ivanova
Published: 30 December 2017
Science Evolution, Volume 2, pp 44-48; https://doi.org/10.21603/2500-1418-2017-2-2-44-48

Abstract:
The present paper illustrates the results of the study on chromatographic behavior and optimization of some parameters of the method of quantitative determination of bornyl acetate and isobornyl acetate diastereomers under the conditions of reversed-phase high- performance liquid chromatography. Chromatography was performed with HPLC platform Agilent 1200 with diode-matrix detector and a column Agilent Zorbax XDB, Extend-C18. Detection of the studied analytes was performed at a wavelength of 210 nm. Determinationof the concentration of bornyl acetate isomers was carried out in mixture with other components of the Abiessibirica essential oil in chromatographic systems with mobile phases of acetonitrile-water or isopropyl alcohol-water. The range of analyte concentrations in a sample was varied from 2 to 430 mg/ml for bornyl acetate and from 2 to 950 mg/ml for isobornyl acetate. It is stated that in a chromatographic system with a mobile phase, based on acetonitrile, the peaks of the studied components have an asymmetric shape, and the retention times of analytes increase with the decrease of their concentrations in a sample. In a chromatographic system with isopropyl alcohol the asymmetry of the bornyl acetate peak disappears, the width decreases and the retention time stabilizes. For isobornyl acetate a peak width also decreases, its asymmetry is preserved, but at the same time, the asymmetry coefficient takes on permitted values (less than 2). Calibration charts for the mentioned compounds in the used eluents are linear throughout the studiedconcentration range with correlation coefficients of R2>0.998. Thus, the conducted researches allow to recommend the reversed-phaseHPLC variant for the separate quantitative determination of bornyl acetate and isobornyl acetate in the pine oil samples.
Zoya Esina, Alexander Miroshnikov, Margarita Korchuganova, Kemerovo State University, Kemerovo Institute of Food Science and Technology (University), Mbnou «City Classical Lyceum»
Published: 30 December 2017
Abstract:
Primary and secondary alcohols, obtained as a product of processing of plant raw materials, can be used as additives in fuel. Mixtures of n-alkanes, cyclic alkanes and aromatic hydrocarbons can act as a model for gasoline and diesel fuel. Therefore, it is necessary to study the characteristics of mixtures of alcohols with normal, cyclic and aromatic hydrocarbons. To simulate liquid-solid and liquid-vapor phase equilibria, a method is used to minimize excess Gibbs energy by the solvation parameter. The authors developed the PCEAS (Phase Charts Eutectic and Azeotropic Systems) software. The input data in the case of constant pressure are the temperature T 0 and the enthalpy of the phase change H 0 of the pure components. Prediction of the thermodynamic parameters of secondary alcohols is used to calculate the eutectic and azeotropic parameters of the secondary alcohol - n-alkane mixture: composition, temperature, melting enthalpy and evaporation. The model makes it possible to determine the average value of the association parameter in the liquid phase k . Experimental data for azeotropic mixtures made it possible to establish the association parameter in the vaporphase  of the systems under study. The results of calculations can be used to select the optimal composition and obtain the requiredcharacteristics of biofuel.
Aleksandra Zaushintsena,
Published: 30 December 2017
Science Evolution, Volume 2, pp 22-32; https://doi.org/10.21603/2500-1418-2017-2-2-22-32

Abstract:
The technology of creating varieties of barley resistant to the smut diseases has been developed. Their cultivation will help to reduce crop losses, increase the profitability of seed production, improve the quality of seeds, and reduce the environmental risk from the use of chemical plant protection products. This technology was first implemented in the Kemerovo Region in 1988-1999. The wide distribution of species Ustilago nuda (Jens.) Kell. et Sw. (65 %) and U. nigra Tapke (35 %) was revealed. The covered smut ( Ustilago hordei (Pers.) Kell. Et Sw.) was registered in individual collection varieties. The first and tenth races of a loose smut and the sixth race of a black loose smut were identified. The sources of individual and group immunity to the smut fungi from the world gene pool of barley are distinguished: Moskovsky 3/125, Suzdalets, Ramos (Moscow Region); Kazer (Rostov Region); line 3 KM-1192 (Belarus); Kumir Odessky (Ukraine); Guardian (Canada). The donor properties of resistance to a loose smut in the Bagan variety, line 53 HVS 91/76, line 1899 were studied. They are recommended for use in breeding programs. With their participation a new hybrid fund was created. Variability and inheritance of quantitative traits of productivity of hybrids was studied. To select the recombinants immune to the loose smut in combination with high productivity, the most promising combinations of hybrids have been identified: Bagan × Viner; Bagan × KM-16; l. 53 HVS 91/76 × KM-7; KM-7 × l. 1899; l. 1899 × KM-7. Among them, prospective breeding lines have been selected. The results of the implementation of technology elements in the selection of barley for resistance to smut fungi is the creation of immune highly productive varieties of a new generation: Simon and Luka (Kemerovo Region). They are included in the State register of breeding achievements since 2004.
Nikolay Kucher, Aleksandra Zhalnina, Kemerovo State University
Published: 30 December 2017
Science Evolution, Volume 2, pp 54-71; https://doi.org/10.21603/2500-1418-2017-2-2-54-71

Abstract:
Mathematical models of multi-velocity continua, through which the motion of multicomponent mixtures are described, represent a rather extensive area of modern mechanics and mathematics. Mathematical results (statements of problems, theorems on the existence and uniqueness, properties of solutions, etc.) for such models are rather modest in comparison with the results for classical single-phase media. The present paper aims to fill this gap in some extent and is devoted to investigating the global correctness of the boundary value problem for a nonlinear system of differential equations, which is some regularity of the mathematical model of nonstationary spatial flows of a mixture of viscous compressible fluids. Construction of the solution of the problem considered in this article is a key step for the mathematical analysis of the initial model of the mixture, since it allows to obtain globally defined solutions of the latter by means of a limiting transition and, in addition, the proposed algorithm for constructing solutions to the regularized problem is practical. This algorithm is based on the finite-dimensional approximation procedure for an infinite-dimensional problem, and therefore a mathematically grounded algorithm for the numerical solution of the boundary value problem of the motion of a mixture of viscous compressible fluids in a region bounded by solid walls can be constructed on this basis. The local in time solvability of finite- dimensional problems is proved by applying the principle of contracting mappings and the local solution can be extended to an arbitrary time interval with the help of a priori estimates.
Sergey Pachkin, Roman Kotlyarov, Kemerovo Institute of Food Science and Technology (University)
Published: 30 December 2017
Science Evolution, Volume 2, pp 72-78; https://doi.org/10.21603/2500-1418-2017-2-2-72-78

Abstract:
One of the main tasks solved in the development of automatic control systems is the identification of the control object, which consists in obtaining its mathematical description. The nature and type of the mathematical model is determined by the goals and tasks for which it will be used. In the present case, the aim of obtaining the model is the synthesis of an automatic control system. Proceeding from the requirements of control problems, the identification problem consists in determining the structure and parameters of the mathematical model that ensure the best similarity of the model and object responses to the same input action. The article considers the experimental method of obtaining a mathematical description of the control object based on the results of measuring its input and output parameters and then processing the obtained results. The control object is the EP10 emulator made by the Oven Company, which is a miniature furnace. The emulator is used in experimental research in the process of commissioning using thermostat controls, and also applicable for educational purposes as part of training and research stands. As a result of structural identification with subsequent adjustment of the coefficients with the help of parametric identification, a model of the control object in the form of a second order aperiodic link is obtained. Parameters and type of the mathematical model allowed to make calculations and determine the parameters of adjustment of the TRM251 PID-controller. The software implementation of the automatic control system in the MatLAB environment made it possible to evaluate transient processes in a closed system. Thus, the calculation and analysis of the automatic control system in the first approximation were made. The final result can be obtained at the stage of commissioning the automatic temperature control system in the EP10 emulator using adaptation algorithms.
Alexander Prosekov, , Irina Milenteva,
Published: 30 December 2017
Abstract:
Bacteriocins are antibacterial, mainly complex, substances of protein nature. The promising strains producing bacteriocins used in the food industry are lactic acid microorganisms. This study examines the development of a technology for the production of a recombinant peptide with broad-spectrum antimicrobial properties. An important step is the isolation and purification of the recombinant peptide. It has been proved that the highest antimicrobial activity is manifested by a recombinant peptide isolated by a method based on salting out with ammonium sulfate. During the purification of the recombinant bacteriocin preparation, three kinds of columns were used. In the purification process, the volume of bacteriocin produced decreases 3-fold, while the RU/mL increases 3-fold, and RU/mg increases 6-fold. Purification allows the use of a smaller amount of recombinant bacteriocin in technologies with greater efficacy. Based on the results of determining the molecular weight and purity of the recombinant bacteriocin, it was found that the molecular weight of the recombinant bacteriocin having the amino acid sequence: KYYGNGVTCCKHSCSVDXGKASSCIINNGAMAXATGGH GGNHCCGMSRYIQGIPDFLRGYLHGISSANKHKKGRL, is 13 kDa. A technology for the preparation of a broad-action antimicrobial spectrum peptide has been developed. The process of production of antimicrobial peptide includes such stages as: cultivation of the recombinant strain of Escherichia coli BL21DE3; separation of biomass from the nutrient medium; precipitation of bacteriocins by ammonium sulfate; centrifugation; washing the precipitate; centrifugation at 4200 rpm and separation of the preparation; purification of bacteriocins by HPLC method; packing in bags of polymeric and combined materials; storage at a temperature of 18±2°C for 12 months.
, Daegyu Kim, ManSoo Choi
Published: 30 December 2017
Science Evolution, Volume 2, pp 96-101; https://doi.org/10.21603/2500-1418-2017-2-2-96-101

Abstract:
We show that multiple-photon absorption of radiation from a 10.56 μm cw CO2 laser by intermediates (ethylene, vinylidene) generated in pure acetylene flow makes them decompose to carbon dimers and excited hydrogen. The latter associates with downstream acetylene to feedback those laser absorbing intermediates thus making the reactions self-sustained in the absence of oxygen. This process is different from acetylene self-decomposition that may occur at higher temperature and pressure. The results of our work may be useful for understanding the generation of various carbon allotropes and interstellar dust from acetylene.
Irina Alexandrova, , Irina Tsyganok
Published: 30 December 2017
Abstract:
In the present paper we give a rough classification of exterior differential forms on a Riemannian manifold. We define conformal Killing, closed conformal Killing, coclosed conformal Killing and harmonic forms due to this classification and consider these forms on a Riemannian globally symmetric space and, in particular, on a rank-one Riemannian symmetric space. We prove vanishing theorems for conformal Killing L 2-forms on a Riemannian globally symmetric space of noncompact type. Namely, we prove that every closed or co-closed conformal Killing L 2-form is a parallel form on an arbitrary such manifold. If the volume of it is infinite, then every closed or co-closed conformal Killing L 2-form is identically zero. In addition, we prove vanishing theorems for harmonic forms on some Riemannian globally symmetric spaces of compact type. Namely, we prove that all harmonic one-formsvanish everywhere and every harmonic r -form  r  2 is parallel on an arbitrary such manifold. Our proofs are based on the Bochnertechnique and its generalized version that are most elegant and important analytical methods in differential geometry “in the large”.
Back to Top Top